PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.C00701.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 203aa    MW: 23034.3 Da    PI: 9.7582
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.C00701.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF75.73.6e-241056248
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                    rien   r vtfskR++g+lKKA ELSvLC+a+v viifsstgk+++
  Pahal.C00701.1 10 RIENPVHRRVTFSKRQEGLLKKARELSVLCGADVGVIIFSSTGKVHD 56
                    8********************************************97 PP

2K-box33.22.2e-128517213100
           K-box  13 kaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                      ++  +q ++ L+ ei +Lq+ + +  G + +++ l  L+ Le+ Le    + Rs+K++++ ++i+ l++ke  l+++n+ L++k++e
  Pahal.C00701.1  85 RSQVTEQWISLLRHEIGQLQHGLSRSTGGGQGDMRLDRLHMLEKGLELWYCQTRSTKMQIMQQEIQVLKNKETILKSANEILQEKVNE 172
                     45667888999**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554555.36E-27177IPR002100Transcription factor, MADS-box
PROSITE profilePS5006627.88161IPR002100Transcription factor, MADS-box
SMARTSM004323.3E-33160IPR002100Transcription factor, MADS-box
CDDcd002651.91E-34378No hitNo description
PRINTSPR004048.5E-24323IPR002100Transcription factor, MADS-box
PfamPF003195.5E-231055IPR002100Transcription factor, MADS-box
PRINTSPR004048.5E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004048.5E-243859IPR002100Transcription factor, MADS-box
PfamPF014864.4E-1385170IPR002487Transcription factor, K-box
PROSITE profilePS512979.62486176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MVRGKVQMRR IENPVHRRVT FSKRQEGLLK KARELSVLCG ADVGVIIFSS TGKVHDLATN  60
GNMQSLVERY QSIAARGQME SKNLRSQVTE QWISLLRHEI GQLQHGLSRS TGGGQGDMRL  120
DRLHMLEKGL ELWYCQTRST KMQIMQQEIQ VLKNKETILK SANEILQEKV NEQNQFMNNC  180
SAFSGSSYST HYDANESCLF TI*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012700445.11e-83PREDICTED: MADS-box transcription factor 33-like
SwissprotQ2QW555e-84MAD33_ORYSJ; MADS-box transcription factor 33
TrEMBLA0A0E0BQC55e-83A0A0E0BQC5_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0J7X25e-83A0A0E0J7X2_ORYNI; Uncharacterized protein
TrEMBLA2ZIY85e-83A2ZIY8_ORYSI; Putative uncharacterized protein
TrEMBLA3CFV15e-83A3CFV1_ORYSJ; Uncharacterized protein
STRINGBGIOSGA036463-PA1e-82(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.19e-52AGAMOUS-like 12